PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G21780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 326aa    MW: 35721.7 Da    PI: 5.8845
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G21780.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.22.2e-091659140
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT....TTS-HHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg....kgRtlkqc 40
                     +g W++eEd++l++ + ++G g+W+++++  g    + + + +c
  OMERI05G21780.1 16 KGLWSPEEDDKLYNHIIRHGVGCWSSVPKLAGkqerTQLIDRHC 59
                     678*****************************855555555555 PP

2Myb_DNA-binding52.51.1e-1692135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++l+v +++ lG++ W+ Ia++++ gRt++++k++w++
  OMERI05G21780.1  92 RGSFSQQEEDLIVALHEILGNR-WSQIASHLP-GRTDNEIKNFWNS 135
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-211189IPR009057Homeodomain-like
PROSITE profilePS500909.0361186IPR017877Myb-like domain
SuperFamilySSF466891.2E-71353IPR009057Homeodomain-like
SMARTSM007172.0E-81588IPR001005SANT/Myb domain
PfamPF002496.6E-101686IPR001005SANT/Myb domain
CDDcd001678.72E-81986No hitNo description
SuperFamilySSF466895.53E-2172145IPR009057Homeodomain-like
PROSITE profilePS5129426.03887141IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2690141IPR009057Homeodomain-like
SMARTSM007172.5E-1691139IPR001005SANT/Myb domain
PfamPF002497.0E-1592136IPR001005SANT/Myb domain
CDDcd001672.68E-1194134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGRLSSCGGV QAKLRKGLWS PEEDDKLYNH IIRHGVGCWS SVPKLAGKQE RTQLIDRHCR  60
FGELDWANFG LQRCGKSCRL RWINYLRPDL KRGSFSQQEE DLIVALHEIL GNRWSQIASH  120
LPGRTDNEIK NFWNSCLKKK LRQRGLDPAT HKPIAAAATS SASAVTQVDE DHKPHVAADG  180
LAANAKQSVF DPFPVTDFGA GFDLGAANMA AALYGSHPDD GAGFVADYSS VLDVSDNLGY  240
GESSSNSSNW TCAEVSNVLD REVLNWAASA AAAAAAKAEP FADMEQQHSG YGGEHQVEDD  300
AALEHKFSLP CHEQSLAQFD FNLEYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24141415108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136142LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8377890.0CT837789.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN047M16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638185.10.0PREDICTED: myb-related protein Hv33
SwissprotP200271e-115MYB3_HORVU; Myb-related protein Hv33
TrEMBLA0A0E0DUC80.0A0A0E0DUC8_9ORYZ; Uncharacterized protein
STRINGORGLA05G0210500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-69myb domain protein 86